Hubbry Logo
search button
Sign in
Thraustochytrium mitochondrial code
Thraustochytrium mitochondrial code
Comunity Hub
History
arrow-down
starMore
arrow-down
bob

Bob

Have a question related to this hub?

bob

Alice

Got something to say related to this hub?
Share it here.

#general is a chat channel to discuss anything related to the hub.
Hubbry Logo
search button
Sign in
Thraustochytrium mitochondrial code
Community hub for the Wikipedia article
logoWikipedian hub
Welcome to the community hub built on top of the Thraustochytrium mitochondrial code Wikipedia article. Here, you can discuss, collect, and organize anything related to Thraustochytrium mitochondrial code. The ...
Add your contribution
Thraustochytrium mitochondrial code

The Thraustochytrium mitochondrial code (translation table 23) is a genetic code found in the mitochondria of the labyrinthulid protist Thraustochytrium aureum.[1] The mitochondrial genome was sequenced by the Organelle Genome Megasequencing Program.

Code

[edit]
   AAs = FF*LSSSSYY**CC*WLLLLPPPPHHQQRRRRIIIMTTTTNNKKSSRRVVVVAAAADDEEGGGG
Starts = --------------------------------M--M---------------M------------
 Base1 = TTTTTTTTTTTTTTTTCCCCCCCCCCCCCCCCAAAAAAAAAAAAAAAAGGGGGGGGGGGGGGGG
 Base2 = TTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGG
 Base3 = TCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAG

Bases: adenine (A), cytosine (C), guanine (G) and thymine (T) or uracil (U).

Amino acids: Alanine (Ala, A), Arginine (Arg, R), Asparagine (Asn, N), Aspartic acid (Asp, D), Cysteine (Cys, C), Glutamic acid (Glu, E), Glutamine (Gln, Q), Glycine (Gly, G), Histidine (His, H), Isoleucine (Ile, I), Leucine (Leu, L), Lysine (Lys, K), Methionine (Met, M), Phenylalanine (Phe, F), Proline (Pro, P), Serine (Ser, S), Threonine (Thr, T), Tryptophan (Trp, W), Tyrosine (Tyr, Y), Valine (Val, V)


Differences from the standard code

[edit]

It is the similar to the bacterial code (translation table 11) but it contains an additional stop codon (TTA) and also has a different set of start codons.

DNA codons RNA codons This code (23) Standard code (1)
TTA UUA STOP = Ter (*) Leu (L)

Systematic range and comments

[edit]

See also

[edit]

References

[edit]

This article incorporates text from the United States National Library of Medicine, which is in the public domain. [2]

  1. ^ Wideman, Jeremy G.; Monier, Adam; Rodríguez-Martínez, Raquel; Leonard, Guy; Cook, Emily; Poirier, Camille; Maguire, Finlay; Milner, David S.; Irwin, Nicholas A. T.; Moore, Karen; Santoro, Alyson E. (25 November 2019). "Unexpected mitochondrial genome diversity revealed by targeted single-cell genomics of heterotrophic flagellated protists". Nature Microbiology. 5 (1): 154–165. doi:10.1038/s41564-019-0605-4. hdl:10871/39819. ISSN 2058-5276. PMID 31768028. S2CID 208279678.
  2. ^ Elzanowski A, Ostell J, Leipe D, Soussov V. "The Genetic Codes". Taxonomy browser. National Center for Biotechnology Information (NCBI), U.S. National Library of Medicine. Retrieved 11 August 2016.
[edit]