Hubbry Logo
Protein tagProtein tagMain
Open search
Protein tag
Community hub
Protein tag
logo
7 pages, 0 posts
0 subscribers
Be the first to start a discussion here.
Be the first to start a discussion here.
Protein tag
Protein tag
Protein tag
View on Wikipedia
from Wikipedia

Protein tags are peptide sequences genetically grafted onto a recombinant protein. Tags are attached to proteins for various purposes. They can be added to either end of the target protein, so they are either C-terminus or N-terminus specific or are both C-terminus and N-terminus specific. Some tags are also inserted at sites within the protein of interest; they are known as internal tags.[1]

Affinity tags are appended to proteins so that they can be purified from their crude biological source using an affinity technique. Affinity tags include chitin binding protein (CBP), maltose binding protein (MBP), Strep-tag[2] and glutathione-S-transferase (GST). The poly(His) tag is a widely used protein tag, which binds to matrices bearing immobilized metal ions.

Solubilization tags are used, especially for recombinant proteins expressed in species such as E. coli, to assist in the proper folding in proteins and keep them from aggregating in inclusion bodies. These tags include thioredoxin (TRX) and poly(NANP). Some affinity tags have a dual role as a solubilization agent, such as MBP and GST.

Chromatography tags are used to alter chromatographic properties of the protein to afford different resolution across a particular separation technique. Often, these consist of polyanionic amino acids, such as FLAG-tag or polyglutamate tag.[3]

Epitope tags are short peptide sequences which are chosen because high-affinity antibodies can be reliably produced in many different species. These are usually derived from viral genes, which explain their high immunoreactivity. Epitope tags include ALFA-tag, V5-tag, Myc-tag, HA-tag, Spot-tag, T7-tag and NE-tag. These tags are particularly useful for western blotting, immunofluorescence and immunoprecipitation experiments, although they also find use in antibody purification.

Fluorescence tags are used to give visual readout on a protein. Green fluorescent protein (GFP) and its variants are the most commonly used fluorescence tags.[4] More advanced applications of GFP include using it as a folding reporter (fluorescent if folded, colorless if not).

Protein tags may allow specific enzymatic modification (such as biotinylation by biotin ligase) or chemical modification (such as coupling to other proteins through SpyCatcher or reaction with FlAsH-EDT2 for fluorescence imaging). Often tags are combined, in order to connect proteins to multiple other components. However, with the addition of each tag comes the risk that the native function of the protein may be compromised by interactions with the tag. Therefore, after purification, tags are sometimes removed by specific proteolysis (e.g. by TEV protease, Thrombin, Factor Xa or Enteropeptidase) or intein splicing.

List of protein tags

[edit]

(See Proteinogenic amino acid#Chemical properties for the A-Z amino-acid codes)

Peptide tags

[edit]
  • ALFA-tag, a de novo designed helical peptide tag (SRLEEELRRRLTE) for biochemical and microscopy applications. The tag is recognized by a repertoire of single-domain antibodies [5]
  • AviTag, a peptide allowing biotinylation by the enzyme BirA and so the protein can be isolated by streptavidin (GLNDIFEAQKIEWHE)
  • EPEA-tag, commercially called CaptureSelect C-tag, a 4 AA peptide that is recognized by a VHH or single-domain camelid antibody which was discovered through phage display (EPEA)[6][7]
  • Calmodulin-tag, a peptide bound by the protein calmodulin (KRRWKKNFIAVSAANRFKKISSSGAL)
  • iCapTag™ (intein Capture Tag), a self-removing peptide-based tag (MIKIATRKYLGKQNVYGIGVERDHNFALKNGFIAHN). The iCapTag™ is controlled by pH change (typically pH 8.5 to pH 6.2). Therefore, this technology can be adapted to a wide range of buffers adjusted to the target pH values of 8.5 and 6.2. The expected purity of target proteins or peptides is between 95-99%. The iCapTag™ contains patented component derived from Nostoc punctiforme (Npu) intein. This tag is used for protein purification of recombinant proteins and its fragments. It can be used in research labs and it is intended for large-scale purification during downstream manufacturing process as well. The iCapTag™-target protein complex can be expressed in a wide range of expression hosts (e.g. CHO and E.coli cells). It is not intended for fully expressed mAbs[8][9][10]
  • polyglutamate tag, a peptide binding efficiently to anion-exchange resin such as Mono-Q (EEEEEE) [3]
  • polyarginine tag, a peptide binding efficiently to cation-exchange resin (from 5 to 9 consecutive R)
  • E-tag, a peptide recognized by an antibody (GAPVPYPDPLEPR)
  • FLAG-tag, a peptide recognized by an antibody (DYKDDDDK)[11]
  • HA-tag, a peptide from hemagglutinin recognized by an antibody (YPYDVPDYA)[12]
  • His-tag, 5-10 histidines bound by a nickel or cobalt chelate (HHHHHH)
    • Gly-His-tags are N-terminal His-Tag variants (e.g. GHHHH, or GHHHHHH, or GSSHHHHHH) that still bind to immobilised metal cations but can also be activated via azidogluconoylation to enable click-chemistry applications[13]
  • Myc-tag, a peptide derived from c-myc recognized by an antibody (EQKLISEEDL)
  • NE-tag, an 18-amino-acid synthetic peptide (TKENPRSNQEESYDDNES) recognized by a monoclonal IgG1 antibody, which is useful in a wide spectrum of applications including Western blotting, ELISA, flow cytometry, immunocytochemistry, immunoprecipitation, and affinity purification of recombinant proteins [14]
  • Rho1D4-tag, refers to the last 9 amino acids of the intracellular C-terminus of bovine rhodopsin (TETSQVAPA). It is a very specific tag that can be used for purification of membrane proteins.
  • S-tag, a peptide derived from Ribonuclease A (KETAAAKFERQHMDS)
  • SBP-tag, a peptide which binds to streptavidin (MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP)[15]
  • Softag 1, for mammalian expression (SLAELLNAGLGGS)
  • Softag 3, for prokaryotic expression (TQDPSRVG)
  • Spot-tag, a peptide recognized by a nanobody (PDRVRAVSHWSS) for immunoprecipitation, affinity purification, immunofluorescence and super resolution microscopy
  • Strep-tag, a peptide which binds to streptavidin or the modified streptavidin called streptactin (Strep-tag II: WSHPQFEK)[2]
  • T7-tag, an epitope tag derived from the T7 major capsid protein of the T7 gene (MASMTGGQQMG). Used in different immunoassays as well as affinity purification Mainly used [16]
  • TC tag, a tetracysteine tag that is recognized by FlAsH and ReAsH biarsenical compounds (CCPGCC)
  • Ty tag (EVHTNQDPLD)
  • V5 tag, a peptide recognized by an antibody (GKPIPNPLLGLDST)[17]
  • VSV-tag, a peptide recognized by an antibody (YTDIEMNRLGK)
  • Xpress tag (DLYDDDDK), a peptide recognized by an antibody

Covalent peptide tags

[edit]
  • Isopeptag, a peptide which binds covalently to pilin-C protein (TDKDMTITFTNKKDAE)[18]
  • SpyTag, a peptide which binds covalently to SpyCatcher protein (AHIVMVDAYKPTK)[19]
  • SnoopTag, a peptide which binds covalently to SnoopCatcher protein (KLGDIEFIKVNK).[20] A second generation, SnoopTagJr, was also developed to bind to either SnoopCatcher or DogTag (mediated by SnoopLigase) (KLGSIEFIKVNK)[21]
  • DogTag, a peptide which covalently binds to DogCatcher (DIPATYEFTDGKHYITNEPIPPK),[22] and can also covalently bind to SnoopTagJr, mediated by SnoopLigase [21]
  • SdyTag, a peptide which binds covalently to SdyCatcher protein (DPIVMIDNDKPIT).[23] SdyTag/SdyCatcher has a kinetic-dependent cross-reactivity with SpyTag/SpyCatcher.

Protein tags

[edit]
  • BCCP (Biotin Carboxyl Carrier Protein), a protein domain biotinylated by BirA enabling recognition by streptavidin
  • BromoTag, a "bump-and-hole" mutated version of the second bromodomain of Brd4, Brd4-BD2 L387A, that can be highly selectively bound by tag-specific PROTAC degrader AGB1 to form a ternary complex between the "BromoTagged" protein and the E3 ligase VHL, leading to ubiquitination of the tagged protein and its subsequent rapid and effective proteasomal degradation in cells.[24]
  • FAST (Fluorescence-Activating and absorption-Shifting Tag), a mutated photoactive yellow protein (PYP) that reversibly binds cognate fluorogenic ligands
  • CL7-tag, an engineered variant of Colicin E7 that has a strong binding affinity and specificity for immobilized Immunity Protein 7 (Im7).[25]
  • Glutathione-S-transferase-tag, a protein which binds to immobilized glutathione
  • Green fluorescent protein-tag,[4] a protein which is spontaneously fluorescent and can be bound by nanobodies
  • HaloTag, a mutated bacterial haloalkane dehalogenase that covalently attaches to haloalkane substrates
  • SNAP-tag, a mutated eukaryotic DNA methyltransferase that covalently attaches to benzylguanine derivatives
  • CLIP-tag, a mutated eukaryotic DNA methyltransferase that covalently attaches to benzylcytosine derivatives
  • HUH-tag, a sequence-specific single-stranded DNA binding protein that covalently binds to its target sequence
  • Maltose binding protein-tag, a protein which binds to amylose agarose[26]
  • Nus-tag
  • Thioredoxin-tag
  • Fc-tag, derived from immunoglobulin Fc domain, allow dimerization and solubilization. Can be used for purification on Protein-A Sepharose
  • Designed Intrinsically Disordered tags containing disorder promoting amino acids (P,E,S,T,A,Q,G,..)[27]
  • Carbohydrate Recognition Domain or CRDSAT-tag, a protein which binds to lactose agarose or Sepharose[28]

Others

[edit]

HiBiT-tag was developed by Scientists at Promega. It is an 11-amino-acid peptide tag, and it can be fused to the N- or C-terminus or internal locations of proteins.[29] Its small size leads to a rapid knock-in of this tag with other proteins through CRISPR/Cas9 technology.[29]

Applications

[edit]

References

[edit]
Revisions and contributorsEdit on WikipediaRead on Wikipedia

Protein tag

View on Grokipedia
from Grokipedia
A protein tag is a short peptide or protein sequence that is genetically fused to a recombinant protein to facilitate its purification, detection, solubilization, localization, or other functional analyses in research. These tags are typically engineered into expression vectors and attached to either the N- or C-terminus of the target protein, allowing specific interactions with antibodies, ligands, or matrices for downstream applications. Common purposes include affinity purification under native or denaturing conditions, visualization in cellular imaging, and enhancement of protein stability during expression in host systems like E. coli or eukaryotic cells. The concept of protein tagging originated in the 1980s with the use of larger fusion partners, such as staphylococcal (approximately 280 ), primarily for protein expression and purification in bacterial systems. Over time, advancements led to the development of smaller, more versatile tags to minimize interference with the protein's native structure and function, with the polyhistidine () emerging as one of the earliest and most widely adopted in the due to its simplicity and compatibility with immobilized metal (). Today, protein tags are integral to recombinant protein production, enabling high-throughput workflows in and . Key types of protein tags include affinity tags like the (2–10 histidine residues) for metal chelation-based purification, glutathione S-transferase (GST, 211 ) for glutathione affinity, and (, 396 ) to improve solubility. Epitope tags, such as (8 ) and (, 9–13 ), are short sequences recognized by specific monoclonal antibodies for detection in immunoassays like Western blotting or . Fluorescent tags, including () and its variants (e.g., ), allow real-time tracking of protein localization and dynamics in live cells. Self-labeling enzyme tags like and enable covalent attachment of dyes or probes for advanced imaging and studies. In practice, protein tags often incorporate protease cleavage sites (e.g., tobacco etch virus , TEV) to remove the tag post-purification, preserving the protein's native state for functional assays. While tags generally enhance experimental efficiency, their selection depends on the host organism, protein properties, and application—such as using Strep-tag II for gentle purification in sensitive eukaryotic expressions. Recent developments include optimized tags for non-model organisms like and multi-tag systems for simultaneous purification and labeling, broadening their utility in and .

Fundamentals

Definition

Protein tags are short peptide sequences, typically comprising 6 to 20 amino acids, or larger polypeptides that are genetically fused to a recombinant target protein to enable specific interactions for experimental manipulation, such as purification, detection, or solubilization enhancement. These tags are incorporated into the protein sequence during cloning by inserting the corresponding DNA fragment into the expression vector, ensuring the fusion does not alter the native amino acid sequence of the target protein itself. A key distinction exists between epitope tags and affinity tags. Epitope tags are small peptides recognized by specific antibodies, facilitating detection and localization of the fused protein in assays like immunoassays or Western blotting. In contrast, affinity tags bind selectively to immobilized partners, such as metal ions or ligands on chromatography matrices, allowing for efficient purification of the target protein from complex mixtures. The basic mechanism of protein tags involves providing a non-native "handle" on the target protein that exploits high-affinity interactions with exogenous molecules, while minimizing interference with the protein's folding or activity. Tags are predominantly placed at the N- or to preserve the target's structural integrity, as internal insertions are rare due to the high risk of disrupting critical domains, secondary structures, or functional sites. This terminal positioning, achieved through standard techniques, supports applications like for isolation.

Historical Development

Early fusion proteins, such as those using β-galactosidase from the lacZ gene in Escherichia coli, emerged in the mid-1970s to monitor gene expression through enzymatic activity. These fusions, developed using techniques like bacteriophage-mediated transposition, allowed researchers to create hybrid proteins where β-galactosidase served as a reporter for studying promoters and gene regulation. By the late 1970s and early 1980s, such fusions were routinely employed to study protein localization and function. The concept of protein tags for purification and detection originated in the 1980s with larger fusion partners like staphylococcal protein A. In the mid-1980s, affinity purification advanced significantly with the introduction of the polyhistidine (His-tag) system, developed by Hochuli and colleagues for selective binding to immobilized metal ions like nickel. This small tag, typically six or more histidine residues, enabled one-step purification under mild conditions, revolutionizing recombinant protein isolation. Concurrently, epitope tags emerged for antibody-based detection: the hemagglutinin (HA) tag, derived from influenza virus glycoprotein (amino acids 98-106), was first utilized in 1988 for epitope tagging in mammalian cells, while the FLAG tag, an eight-amino-acid peptide (DYKDDDDK), was also introduced that year to facilitate monoclonal antibody recognition without disrupting protein function. The glutathione S-transferase (GST) tag gained popularity in the late 1980s for its solubility-enhancing properties and affinity to glutathione-agarose, as demonstrated in early fusion protein purifications. The first commercial His-tag purification kits appeared in the late 1980s, commercialized by Roche, making the technology widely accessible. The 2000s brought innovations in self-labeling and versatile tags to address limitations of non-covalent systems. The , a 182-residue engineered variant of O6-alkylguanine-DNA alkyltransferase, was introduced in 2003 for covalent attachment of fluorescent or biotinylated substrates, enabling no-wash imaging and . Smaller, tandem affinity tags like Twin-Strep, a dual II system for enhanced binding to engineered (Strep-Tactin), emerged in the mid-2000s to improve purification yields under physiological conditions. In the 2010s, integration with / facilitated endogenous tagging, allowing precise insertion of tags into native genomic loci without overexpression artifacts, as first demonstrated in human cell lines around 2015. Recent trends emphasize minimal-impact tags, such as ultra-small peptides or self-cleaving systems, to reduce interference with , localization, and interactions while maintaining high specificity. As of 2025, advances include 2 for faster and brighter protein labeling in live cells and methods for non-disruptive incorporation in mammalian cells.

Classification

Small Peptide Tags

Small peptide tags are short sequences, typically comprising fewer than 50 residues, genetically fused to proteins of interest to enable their detection, purification, or localization with minimal perturbation to the target protein's and function. These tags leverage specific interactions with antibodies or metal ions, offering advantages such as low molecular weight (usually 1-2 kDa) and reduced likelihood of altering or activity compared to larger fusion partners. Their compact nature makes them ideal for applications requiring high-fidelity protein behavior, including in mammalian and bacterial expression systems. The polyhistidine tag, commonly known as , consists of 6-10 consecutive residues, with the standard HHHHHH facilitating binding to divalent metal ions like Ni²⁺ or Co²⁺ through the side chains of the histidines. This interaction enables purification via immobilized metal (IMAC), where the tag-metal complex allows selective capture and elution under mild conditions. Developed in 1988 as a genetic approach for recombinant , the His-tag's simplicity and reversibility have made it one of the most widely adopted tools in . The is an 8-amino acid sequence (DYKDDDDK) designed for recognition by high-affinity monoclonal , enabling , detection in immunoassays, and purification under native conditions. Its hydrophilic nature and charged residues contribute to strong antibody binding without requiring harsh steps, preserving protein integrity. Introduced in 1988 as a polypeptide marker for recombinant protein identification, the FLAG-tag is particularly useful in mammalian cell expression where antibody-based detection is preferred. The derives from a 9-amino acid (YPYDVPDYA) in the influenza virus protein, specifically recognized by the 12CA5 for sensitive detection via western blotting, , or . This sequence was identified in through of an antigenic , highlighting its conformational specificity that ensures low background in assays. The HA-tag's small size and high-specificity interaction make it suitable for studying protein localization and interactions in eukaryotic systems. The is a 10-amino acid sequence (EQKLISEEDL) derived from the human c-Myc proto-oncogene, targeted by the 9E10 for robust detection and purification in or . Its was mapped in 1985 using antibodies raised against synthetic peptides from c-Myc, revealing a linear sequence with high affinity in diverse expression hosts. Commonly employed in mammalian systems, the Myc-tag supports tandem configurations with other small tags to enable dual-labeling or sequential purification steps without significantly impacting protein or activity. The Strep-tag II is an 8-amino acid sequence (WSHPQFEK) that binds with high affinity and specificity to engineered variants like Strep-Tactin, enabling gentle purification and detection under native conditions. Developed in the late 1990s as an improvement over the original , it allows reversible binding and elution with or desthiobiotin, minimizing disruption to protein function. This tag is particularly valued for applications in eukaryotic systems requiring mild conditions, such as structural studies or enzymatic assays.

Large Fusion Tags

Large fusion tags consist of polypeptide sequences greater than 10 kDa, typically derived from naturally occurring proteins, that are genetically fused to recombinant target proteins to improve their expression, solubility, and purification efficiency in host systems such as . These tags often provide additional biochemical functions beyond simple affinity binding, such as acting as molecular chaperones to promote proper folding and prevent the formation of insoluble , which are common issues with hydrophobic or eukaryotic proteins expressed in prokaryotic systems. Unlike smaller tags, large fusion tags can shield exposed hydrophobic regions of the target protein, enhancing overall stability, though their substantial size (typically 10-50 kDa) may interfere with downstream applications by masking antigenic epitopes. One prominent example is the S-transferase (GST) tag, a 26 kDa protein derived from the parasitic helminth Schistosoma japonicum. GST enables affinity purification through its specific binding to glutathione-immobilized resins, allowing one-step isolation of fusion proteins under native conditions, and it also aids solubility during expression in E. coli by stabilizing the target polypeptide. The system was pioneered using expression vectors like pGEX, where the GST moiety can be selectively cleaved from the target using site-specific proteases such as or factor Xa, yielding the native protein. However, GST fusions can sometimes promote oligomerization, leading to aggregation in certain cases. Another widely used large tag is (MBP), a 42-43 kDa periplasmic protein from E. coli that binds resins for efficient and with . MBP is particularly effective at enhancing the folding and soluble yield of eukaryotic proteins expressed in bacterial hosts, where it acts passively as a chaperone by interacting with the target's hydrophobic regions to prevent misfolding and inclusion body formation. Vectors such as pMAL incorporate cleavage sites (e.g., TEV or factor Xa) to remove MBP post-purification, though the tag's large size can occasionally block resin binding if the target protein sterically hinders the site. Studies have shown MBP to be superior to GST in solubilizing globular proteins, with fusions often comprising up to 2% of total cellular protein. The small ubiquitin-like modifier (SUMO) tag, approximately 11 kDa and derived from eukaryotic sources such as (Smt3) or SUMO-1, improves expression and in both prokaryotic and eukaryotic systems by serving as a folding site that reduces aggregation. Typically fused at the with an additional His6 tag for nickel-affinity purification, SUMO outperforms traditional tags like GST and MBP in enhancing soluble yields—for instance, achieving up to 90% for challenging proteins like eGFP and 5-25-fold higher expression levels compared to untagged controls. A key advantage is its removal by highly specific SUMO proteases (e.g., Ulp1), which efficiently cleave at the C-terminal to produce a native without additional residues, unlike the sometimes incomplete cleavage in GST or MBP systems. In general, large fusion tags function as chaperone-like carriers that mitigate inclusion body formation by slowing rates or providing a hydrophilic scaffold, thereby increasing the soluble fraction of recombinant proteins from less than 10% to over 50% in many cases. Their size allows shielding of hydrophobic patches but can complicate detection in applications by occluding epitopes, necessitating tag removal. Post-purification cleavage is standard practice to obtain the untagged target protein, often using engineered sites to minimize contamination.

Self-Labeling and Covalent Tags

Self-labeling and covalent tags enable the site-specific attachment of chemical probes to proteins via irreversible covalent bonds, facilitating precise modifications without relying on non-covalent interactions. These tags are particularly valuable for applications requiring high specificity and minimal background labeling in complex cellular environments, such as live-cell imaging and . Unlike traditional affinity tags, they leverage engineered enzymatic mechanisms to react with synthetic substrates conjugated to fluorophores, , or other functional groups, allowing modular and customizable labeling strategies. The , a 19 kDa protein engineered from the human O⁶-alkylguanine-DNA alkyltransferase (AGT) through , forms a covalent thioether bond with O⁶-benzylguanine (BG) derivatives. This reaction transfers the from the substrate to a residue in the tag's , enabling the attachment of diverse probes like fluorescent dyes for visualization or affinity handles for purification. Introduced in 2003 and applied for live-cell labeling in 2004, SNAP-tag exhibits substrate specificity that minimizes off-target reactions, with labeling efficiencies reaching near-completion in minutes under physiological conditions. Its small size preserves protein function, making it suitable for studying dynamic processes like protein trafficking. A variant, the CLIP-tag, is a 20 kDa engineered AGT mutant that specifically reacts with O²-benzylcytosine substrates, forming an analogous while remaining orthogonal to SNAP-tag substrates. This allows simultaneous dual labeling of different proteins in the same cell, such as tracking interacting partners with distinct fluorophores. Developed in , CLIP-tag shares SNAP-tag's rapid kinetics and low background but expands capabilities, with applications in FRET-based interaction studies and multi-color where spectral separation is critical. The , a 33 fusion based on a dehalogenase from species, covalently links to chloroalkane ligands via an alkyl-enzyme intermediate that resolves into a stable ester bond. This self-labeling mechanism supports a broad range of substrates, including those for immobilization on surfaces or conjugation to bright, photostable dyes, with reaction times as short as 15 minutes and high specificity . Introduced in 2008, HaloTag is widely used for protein pull-downs and live-cell tracking due to its robustness in diverse cellular compartments. Covalent peptide tags, such as the LPXTG motif recognized by sortase A, enable enzymatic ligation of probes through transpeptidation, where the threonine-glycine bond is cleaved to form a native isopeptide linkage with nucleophilic substrates like N-terminal peptides bearing labels. This short sequence (typically 5-6 ) integrates into proteins for site-specific C-terminal modification, with sortase-mediated reactions achieving yields over 90% and applicability in cellular contexts when using enhanced sortase variants. Developed for in 2007, these tags provide flexibility for attaching complex probes like or sugars, supporting functional studies in proteins. Collectively, these tags offer irreversible, substrate-specific attachment with minimal cellular background, as their engineered reactivities avoid endogenous interference, enabling high-fidelity labeling for advanced imaging techniques like STED or microscopy. Their development has revolutionized protein studies by allowing repeated or sequential modifications without genetic re-engineering.

Applications

Purification Techniques

Protein tags enable the isolation of recombinant proteins from complex cellular mixtures through , where the tag specifically binds to an immobilized , allowing contaminants to be washed away while the target protein is selectively retained. This approach leverages the engineered affinity of the tag for a matrix, facilitating high-purity recovery under mild conditions that preserve and function. One of the most widely used systems is the polyhistidine (His) tag, typically consisting of 6-10 histidine residues, which binds to immobilized metal ions such as nickel or cobalt on nitrilotriacetic acid (NTA) resins. Developed in the late 1980s, this method allows for efficient one-step purification with binding capacities of approximately 10-50 mg of protein per milliliter of resin. Elution is achieved using a gradient of imidazole (50-500 mM) or low pH, which competes with the His-tag for the metal ions, yielding proteins with purity often exceeding 90% in a single step. The S-transferase (GST) tag, a 26 kDa enzyme from Schistosoma japonicum, provides another robust affinity handle by binding to immobilized on beads. Introduced in , GST purification uses - columns, where the adheres specifically, and occurs with reduced (10-50 mM) under non-denaturing conditions. This system not only simplifies isolation but also enhances solubility of the fused protein, with typical binding capacities around 10 mg per milliliter of resin. Strep-tag systems, particularly the Twin-Strep-tag variant, offer high specificity through reversible binding to engineered streptavidin derivatives like Strep-Tactin. Originating from peptide engineering in the early , the Twin-Strep-tag (a tandem repeat of the 8-amino-acid II) minimizes non-specific interactions due to its low affinity for native but strong interaction with modified versions, enabling elution with (2.5 mM) or desthiobiotin without harsh conditions. This results in exceptionally pure isolates with reduced background binding compared to single-step methods. For enhanced purity, (TAP) employs dual tags, such as a combination of (for IgG binding) and a -binding (CBP), separated by a protease cleavage site. Pioneered in 2001, TAP involves two sequential steps: initial capture on IgG followed by tobacco etch virus ( cleavage and secondary binding to calmodulin , with final elution using EGTA (2 mM). This two-step process achieves purities greater than 95%, ideal for isolating protein complexes while removing co-purifying contaminants. The general workflow for tag-based purification includes cell lysis to release the tagged protein, followed by binding to the affinity matrix under optimized buffer conditions (e.g., 7-8, with salts to reduce non-specific interactions). Washing steps employ buffers with additives like (20-50 mM for His-tags) or NaCl (150-500 mM) to remove unbound material, and recovers the protein in a concentrated form. Typical yields range from 1-10 mg of purified protein per liter of bacterial culture, depending on expression levels and tag efficiency.

Detection and Imaging

Protein tags enable the detection and visualization of recombinant proteins in various experimental contexts, often serving as epitopes for antibody-based recognition or substrates for chemical labeling. These tags facilitate analytical techniques that confirm protein expression, localization, and quantity without relying on native protein properties, which may be unknown or unsuitable for detection. tags, such as (HA) and , are particularly common due to their small size and compatibility with high-affinity antibodies, while self-labeling tags like SNAP expand options for covalent, site-specific imaging. In Western blotting, epitope tags like HA and FLAG are detected using primary antibodies specific to the tag sequence, followed by secondary antibodies conjugated to horseradish peroxidase (HRP) for chemiluminescent signal generation. This method allows for the identification of tagged proteins separated by sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE), with sensitivities reaching nanogram levels per band, enabling detection of low-abundance proteins in complex lysates. For instance, anti-FLAG antibodies can specifically bind the DYKDDDDK sequence, producing clear bands even in the presence of untagged contaminants, provided the sample has been purified as a prerequisite step. Immunofluorescence techniques leverage tags such as or HA to visualize protein localization in fixed cells or tissues. Primary antibodies against the tag are applied, followed by fluorophore-conjugated secondary antibodies, which are then imaged using to achieve high-resolution spatial information. This approach is widely used for studying subcellular distribution, with HA-tagged proteins often visualized in mammalian cells expressing (GFP) fusions for multi-color imaging. The method's specificity minimizes background noise, allowing detection of tagged proteins at endogenous expression levels. For quantitative assays, FLAG tags are employed in enzyme-linked immunosorbent assay () and , where biotinylated anti-FLAG antibodies enable signal amplification through streptavidin-HRP conjugates or fluorescent . In , this setup quantifies soluble tagged proteins with a detection range spanning picograms to micrograms, while uses it to analyze cell-surface or intracellular tag expression in populations, gating for positive events based on intensity. These techniques provide statistically robust data on protein abundance and heterogeneity. Self-labeling tags facilitate imaging by covalently binding synthetic probes, such as near-infrared (NIR) dyes, for non-invasive whole-animal studies. The , derived from human O6-alkylguanine-DNA alkyltransferase, reacts with benzylguanine (BG)-NIR derivatives to label proteins in live mice, enabling deep-tissue penetration and longitudinal tracking with minimal . Recent advancements include SNAP-tag2, an engineered variant offering faster and brighter labeling for improved imaging applications as of 2025. This has been applied to monitor tumor-specific protein expression, with signals detectable at micromolar concentrations over weeks. Quantification in these detection methods often relies on for Western blots, where band intensities are measured relative to standards to estimate protein amounts, achieving limits of detection around 1-10% of total lysate protein. Software tools integrate optical density values to provide linear responses over 1-2 orders of magnitude, ensuring reliable normalization across experiments.

Functional Studies

Protein tags facilitate the study of protein localization within cells by enabling real-time visualization through fluorescent fusion constructs. (GFP) fusions, for instance, allow tracking of protein trafficking and subcellular distribution in living cells without disrupting native functions in many cases. A seminal demonstration involved fusing GFP to the mitochondrial targeting sequence of subunit VIII, which successfully directed the chimeric protein to mitochondria in mammalian cells, enabling dynamic imaging of organelle behavior via fluorescence microscopy. This approach has since been extended to analogous large tags for monitoring proteins in various compartments, such as the nucleus, , and plasma membrane, providing insights into spatial organization and movement. In analyzing protein-protein interactions, tags serve as baits or hooks in affinity-based assays to capture and identify binding partners. The glutathione S-transferase (GST) pull-down assay, where a GST-tagged protein is immobilized on beads to bind prey proteins from cell lysates, has been a cornerstone for interaction studies since its for this purpose. For example, GST fusions have revealed interactions in signaling pathways by pulling down specific partners under controlled conditions. Complementarily, co-immunoprecipitation (co-IP) using small epitope tags like and HA enables detection of interactions in native cellular contexts; dual tagging—one protein with FLAG and its partner with HA—allows reciprocal pulls with specific antibodies, confirming associations while minimizing non-specific binding. This method has been pivotal in mapping complexes, such as those in transcription and pathways. Advanced functional assays leverage tags for measuring interaction dynamics and proximity at nanoscale resolutions. Förster resonance energy transfer (FRET) and bioluminescence resonance energy transfer (BRET) utilize tags paired with fluorescent or luminescent ligands to detect interactions within 10 nm, quantifying conformational changes or binding events in live cells. The , a self-labeling tag, covalently binds chloroalkane-linked dyes serving as FRET acceptors or BRET partners, enabling sensitive proximity measurements; for instance, fusions with donor-acceptor pairs have elucidated transient interactions in cascades with high spatiotemporal precision. Tags also support biophysical analyses of binding kinetics through immobilization on sensor surfaces. Strep-tags, with their high-affinity interaction to Strep-Tactin (dissociation constants in the picomolar range), allow oriented capture of tagged proteins on chips for (SPR) experiments, yielding association (k_on) and dissociation (k_off) rates to compute equilibrium dissociation constants (K_d) spanning 10^{-6} to 10^{-12} M. This has been instrumental in characterizing ligand-receptor affinities and allosteric effects in therapeutic targets. Recent advances in endogenous tagging via / address overexpression artifacts by inserting tags directly into native genomic loci, preserving regulatory contexts for authentic functional studies. -mediated insertion of fluorescent or affinity tags at endogenous sites has enabled visualization of protein dynamics, such as cytoskeletal rearrangements, and interaction mapping in cell lines with successful tagging in a substantial fraction of cells in optimized protocols. This technique, applied to genes like those encoding transcription factors, reveals context-dependent behaviors unattainable with transient transfections.

Implementation

Genetic Engineering Methods

Cloning strategies for incorporating protein tags into target genes typically involve (PCR) amplification of the gene of interest, with primers designed to append the tag sequence directly or via compatible restriction sites. This approach allows precise fusion of the tag to the N- or of the protein during amplification, followed by ligation into an . For bacterial systems, the pET vector series is widely used, enabling high-level expression under the T7 promoter in E. coli hosts like BL21(DE3). In mammalian systems, vectors such as pcDNA facilitate transient or stable expression in cells like HEK293, often incorporating tags for eukaryotic post-translational modifications.01671-1) Advanced vector systems enhance flexibility in tag integration and swapping. Gateway recombination, based on site-specific recombination of att sites, allows rapid transfer of the tagged gene between entry and destination vectors without restriction enzymes, supporting proteome-scale cloning of fusion proteins like His- or GST-tagged constructs. Similarly, Golden Gate assembly uses type IIS restriction enzymes to create seamless, modular fusions, enabling one-pot assembly of multiple elements including tags, promoters, and linkers for customizable expression cassettes across kingdoms. Choice of expression host depends on the tag and protein requirements; E. coli is preferred for simple tags like His6 or GST due to rapid growth and ease of scaling, while HEK293 cells suit complex eukaryotic tags requiring . Codon optimization of the target gene for the host's bias—replacing rare codons with synonymous high-frequency ones—can increase yields by up to 100-fold in heterologous systems, as demonstrated in multi-gene studies. Placement of the tag at the N- or is decided based on protein topology: N-terminal tags avoid interference with C-terminal signals or folding signals, whereas C-terminal tags prevent disruption of N-terminal signal peptides, with empirical testing often needed to assess functionality. To minimize steric hindrance between the tag and target protein, flexible linkers such as glycine-serine (GS)-rich sequences (e.g., (GGGGS)_n where n=1-4, yielding 5-20 ) are inserted, providing rotational freedom and without affecting domain interactions. Verification of successful tag incorporation involves of the construct to confirm in-frame fusion and absence of mutations, followed by pilot expression in small-scale cultures to assess , yield, and tag functionality via or activity assays. This ensures the tagged protein maintains native-like properties before large-scale production.

Cleavage and Removal

Protein tags are often removed post-purification to yield the native target protein, as residual tags can interfere with , activity, or interactions in downstream analyses. Cleavage strategies exploit specific recognition sites or chemical reactivities engineered between the tag and target protein, enabling precise excision while minimizing damage to the protein of interest. These methods preserve the native N- or of the target, which is crucial for functional and structural integrity. Proteolytic cleavage is the most common approach, utilizing highly specific endoproteases to sever the tag at predefined sites. Tobacco etch virus (TEV) protease, a , recognizes the sequence ENLYFQ↓G/S (where ↓ denotes the cleavage site between Gln and Gly/Ser) with high specificity due to its stringent seven-amino-acid recognition motif, achieving over 95% cleavage efficiency under mild conditions of 4–16°C and low salt concentrations (≤200 mM monovalent ions). , a , targets the LVPR↓GS sequence, cleaving between Arg and Gly, though its specificity is lower than TEV's and can result in off-target cuts if contaminating proteases are present. Both enzymes operate at neutral and , facilitating gentle removal without denaturing the protein. Self-cleaving tags employ engineered systems that induce tag excision without external s, reducing contamination risks. The tag is removed by ubiquitin-like 1 (ULP-1), which specifically cleaves at the C-terminal Gly-Gly motif of , yielding near-quantitative (>99%) removal in as little as 10 minutes at a 200:1 substrate-to-enzyme ratio. Intein-based systems, such as those fused to a -binding domain (CBD), enable on-column cleavage; the intein undergoes in the presence of thiols (e.g., DTT or ) at 4–23°C, releasing the untagged protein directly from resin while the intein-CBD remains bound, simplifying purification. Chemical methods provide alternatives when enzymatic sites are incompatible, though they are generally harsher. (CNBr) cleaves at Met↓X bonds (X ≠ Pro) under acidic conditions (70% , 25°C, overnight), allowing tag removal if a unique methionine is placed between the tag and target; however, this method is non-specific if multiple s exist and can cause side reactions like methionine oxidation or homoserine formation. Sortase A, a transpeptidase from , catalyzes sortase-mediated transpeptidation at LPXTG↓ motifs, exchanging the tag for a nucleophile (e.g., or poly-Gly ) under mild aqueous conditions ( 7.5, 37°C), offering site-specificity without harsh reagents. Cleavage efficiency typically ranges from 80–100%, influenced by factors such as /substrate ratio, incubation time, and temperature; over-digestion is avoided by monitoring via and using excess substrate. On-column cleavage, as in intein or immobilized setups, streamlines workflows by combining purification and excision, often yielding higher purity (>95%) than solution-phase methods, which may require additional separation steps to remove the or tag remnants. These strategies are essential for structural studies like , where tags can disrupt crystal packing or mimic non-native interactions, ensuring the target protein adopts its authentic conformation for high-resolution analysis.

Advantages and Limitations

Key Benefits

Protein tags provide significant ease of use in recombinant through the availability of standardized expression vectors and commercial kits, which minimize development time by allowing the same tag to be applied across diverse proteins. For example, systems such as the pET series for His-tagged proteins and pGEX for GST fusions enable straightforward , expression, and purification without custom optimization for each target. This one-tag-fits-many strategy accelerates workflows, often reducing setup from weeks to days in laboratory settings. The modular nature of protein tags enhances versatility, permitting seamless switching between tags for tailored applications, such as employing His-tags for affinity purification via or HA-tags for immunological detection in Western blots and . This adaptability supports a broad range of experimental needs without redesigning the core protein construct. High specificity is a hallmark of protein tags, characterized by low non-specific binding that enables efficient isolation; His-tag-based , for instance, routinely achieves 90-99% purity with minimal background contamination from host proteins. Such precision underpins in , where tags facilitate rapid assessment of thousands of variants in functional assays. Cost-effectiveness is realized through reusable affinity media and antibodies, like Ni-NTA resins that withstand multiple regeneration cycles (at least five), supporting scalable production from milligram to gram scales while lowering per-experiment expenses. Furthermore, tags boost expression yields by up to six-fold in difficult-to-express systems.

Common Challenges

Protein tags can interfere with the native function of the target protein by altering its folding, enzymatic activity, subcellular localization, or interactions with binding partners. For instance, N-terminal tags may occlude signal peptides essential for protein or insertion, thereby preventing proper trafficking. To mitigate such disruptions, researchers often test multiple tag positions (N-terminal, C-terminal, or internal) and validate functionality through assays like activity measurements or localization studies. In vivo applications pose additional risks due to the immunogenicity of certain tags, particularly polyhistidine (His) tags, which can elicit unwanted immune responses in animal models or therapeutic contexts by altering the protein's antigenicity or exposing novel epitopes. His-tagged proteins have been shown to enhance overall immunogenicity and shift the specificity of antibody responses, potentially complicating studies of host-pathogen interactions or vaccine development. Strategies to address this include employing humanized or low-immunogenic tags derived from endogenous sequences, limiting exposure durations, or opting for short-term expression systems. The physical size of tags introduces further complications, as bulky fusions like (MBP, ~40 kDa) can promote unintended dimerization of the target or sterically hinder applications such as by disrupting crystal lattice formation. MBP fusions have been observed to induce interlaced dimers in periplasmic proteins, altering oligomeric states and functional properties. Smaller, cleavable tags are preferred in such cases to minimize these effects while allowing post-purification removal if necessary. Non-specific interactions represent another hurdle, especially during purification from crude cell lysates, where endogenous proteins may bind affinity resins via hydrophobic or metal-chelating motifs, leading to contaminated eluates. His-tagged proteins, for example, often require stringent washes with or high salt to reduce background binding from lysate components. Incorporating negative controls, such as untagged protein expressions or mock purifications, is essential to distinguish specific from non-specific signals. Recent advancements have introduced ultra-small tags under 10 amino acids, such as optimized FLAG (8 aa) or de novo peptide sequences, which exhibit minimal perturbation while enabling efficient purification and detection. Split-tag systems, where tags are divided into non-interfering fragments reassembled in vivo, further reduce functional impacts and background noise. Post-2020 developments include AI-designed minimal epitopes, leveraging machine learning to create compact, high-affinity binders that avoid immunogenicity and size-related issues, as demonstrated in synthetic intrabody designs targeting common tags like FLAG. As of 2025, engineered LOV-domains have been developed as light-responsive protein tags for optogenetic control in cell biology, and novel nuclear degradation tags enable targeted protein destabilization in specific cellular compartments.

References

  1. https://pmc.ncbi.nlm.nih.gov/articles/PMC4527311/
  2. https://pmc.ncbi.nlm.nih.gov/articles/PMC12178573/
  3. https://blog.addgene.org/plasmids-101-protein-tags
  4. https://pubmed.ncbi.nlm.nih.gov/19892176/
  5. https://www.promega.com/resources/pubhub/2019/choosing-a-tag-for-your-protein/
  6. https://pubmed.ncbi.nlm.nih.gov/781293/
  7. https://pubmed.ncbi.nlm.nih.gov/24012791/
  8. https://www.nature.com/articles/s41589-025-01942-z
  9. https://phys.org/news/2025-05-method-cell-protein-tagging-interfering.html
  10. https://pmc.ncbi.nlm.nih.gov/articles/PMC3893739/
  11. https://www.nature.com/articles/nbt1188-1321
  12. https://www.nature.com/articles/nbt1088-1204
  13. https://doi.org/10.1016/0092-8674(84)90412-4
  14. https://pmc.ncbi.nlm.nih.gov/articles/PMC369192/
  15. https://www.iba-lifesciences.com/strep-tag
  16. https://doi.org/10.1016/S0021-9258(99)85291-0
  17. https://www.frontiersin.org/journals/microbiology/articles/10.3389/fmicb.2014.00063/full
  18. https://www.sciencedirect.com/science/article/pii/0378111988900054
  19. https://www.sciencedirect.com/science/article/abs/pii/0378111988901709
  20. https://pmc.ncbi.nlm.nih.gov/articles/PMC2242369/
  21. https://doi.org/10.1038/nbt768
  22. https://doi.org/10.1038/nbt0904-991
  23. https://doi.org/10.1016/j.chembiol.2008.01.004
  24. https://pubs.acs.org/doi/10.1021/cb800025k
  25. https://www.thermofisher.com/us/en/home/life-science/protein-biology/protein-biology-learning-center/protein-biology-resource-library/pierce-protein-methods/his-tagged-proteins-production-purification.html
  26. https://cube-biotech.com/our-science/protein-purification/gst-tag/
  27. https://pubmed.ncbi.nlm.nih.gov/7921186/
  28. https://pubmed.ncbi.nlm.nih.gov/11403571/
  29. https://www.promega.com/resources/guides/protein-analysis/protein-purification-methods/
  30. https://www.med.unc.edu/pharm/sondeklab/wp-content/uploads/sites/868/2018/10/Recombinant-protein-purification-handbook.pdf
  31. https://doi.org/10.1016/S0960-9822(95)00128-X
  32. https://pmc.ncbi.nlm.nih.gov/articles/PMC4752115/
  33. https://pubs.acs.org/doi/10.1021/acschembio.5b00143
  34. https://www.sciencedirect.com/science/article/abs/pii/S1046592816303321
  35. https://www.pnas.org/doi/10.1073/pnas.2302471120
  36. https://www.pnas.org/doi/10.1073/pnas.042684199
  37. https://www.nature.com/articles/s41598-019-46171-2
  38. https://pubmed.ncbi.nlm.nih.gov/18289875/
  39. https://pmc.ncbi.nlm.nih.gov/articles/PMC7784762/
  40. https://pmc.ncbi.nlm.nih.gov/articles/PMC3726540/
  41. https://www.pnas.org/doi/10.1073/pnas.1606731113
  42. https://pubmed.ncbi.nlm.nih.gov/27262188/
  43. https://web.mit.edu/dvp/Public/euj72wc9a8l23dtu.pdf
  44. https://www.nature.com/articles/s41598-024-64938-0
  45. https://doi.org/10.1016/j.jbiotec.2020.10.006
  46. https://pubmed.ncbi.nlm.nih.gov/30550779/
  47. https://www.sciencedirect.com/topics/biochemistry-genetics-and-molecular-biology/protein-tag
  48. https://analyticalsciencejournals.onlinelibrary.wiley.com/doi/pdf/10.1002/biot.201100155
  49. https://www.sciencedirect.com/science/article/abs/pii/S0141813020338010
  50. https://www.researchgate.net/publication/51976647_The_two_faces_of_His-tag_Immune_response_versus_ease_of_protein_purification
  51. https://journals.plos.org/plosone/article?id=10.1371/journal.pone.0148497
  52. https://www.nature.com/articles/s41598-019-56718-y
  53. https://pmc.ncbi.nlm.nih.gov/articles/PMC11239440/
  54. https://www.nature.com/articles/ncomms11046
  55. https://pmc.ncbi.nlm.nih.gov/articles/PMC11839053/
  56. https://pubmed.ncbi.nlm.nih.gov/39592071/
  57. https://pubmed.ncbi.nlm.nih.gov/40287097/
Add your contribution
Related Hubs
User Avatar
No comments yet.