Sermorelin
Sermorelin
Main page
1531079

Sermorelin

logo
Community Hub0 subscribers
Read side by side
Sermorelin
View on Wikipedia
from Wikipedia

Sermorelin
Clinical data
Trade namesGeref, Gerel
Other namesGRF 1–29
AHFS/Drugs.comMicromedex Detailed Consumer Information
Routes of
administration		Injection
ATC code
Legal status
Legal status
  • US: Discontinued[1]
Identifiers
  • L-Tyrosyl-L-alanyl-L-α-aspartyl-L-alanyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-asparaginyl-L-seryl-L-tyrosyl-L-arginyl-L-lysyl-L-valyl-L-leucylglycyl-L-glutaminyl-L-leucyl-L-seryl-L-alanyl-L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-glutaminyl-L-α-aspartyl-L-isoleucyl-L-methionyl-L-seryl-L-argininamide
CAS Number
PubChem CID
DrugBank
ChemSpider
UNII
KEGG
ChEBI
ChEMBL
CompTox Dashboard (EPA)
Chemical and physical data
FormulaC149H246N44O42S
Molar mass3357.93 g·mol−1
3D model (JSmol)
  • CC[C@H](C)[C@@H](C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(=O)N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC2=CC=C(C=C2)O)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CCC(=O)N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(=O)N)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N)NC(=O)[C@H](C)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](C)NC(=O)[C@H](CC3=CC=C(C=C3)O)N
  • InChI=1S/C149H246N44O42S/c1-20-77(13)116(191-122(211)81(17)168-132(221)104(66-113(204)205)178-121(210)79(15)167-123(212)88(152)62-84-39-43-86(198)44-40-84)145(234)185-102(63-83-32-23-22-24-33-83)138(227)193-118(82(18)197)146(235)186-103(65-111(155)202)137(226)189-108(71-196)142(231)182-101(64-85-41-45-87(199)46-42-85)136(225)175-93(38-31-56-165-149(161)162)126(215)174-91(35-26-28-53-151)131(220)190-115(76(11)12)143(232)184-97(58-72(3)4)124(213)166-68-112(203)170-94(47-49-109(153)200)128(217)180-100(61-75(9)10)135(224)188-106(69-194)140(229)169-80(16)120(209)172-92(37-30-55-164-148(159)160)125(214)173-90(34-25-27-52-150)127(216)179-99(60-74(7)8)134(223)181-98(59-73(5)6)133(222)176-95(48-50-110(154)201)129(218)183-105(67-114(206)207)139(228)192-117(78(14)21-2)144(233)177-96(51-57-236-19)130(219)187-107(70-195)141(230)171-89(119(156)208)36-29-54-163-147(157)158/h22-24,32-33,39-46,72-82,88-108,115-118,194-199H,20-21,25-31,34-38,47-71,150-152H2,1-19H3,(H2,153,200)(H2,154,201)(H2,155,202)(H2,156,208)(H,166,213)(H,167,212)(H,168,221)(H,169,229)(H,170,203)(H,171,230)(H,172,209)(H,173,214)(H,174,215)(H,175,225)(H,176,222)(H,177,233)(H,178,210)(H,179,216)(H,180,217)(H,181,223)(H,182,231)(H,183,218)(H,184,232)(H,185,234)(H,186,235)(H,187,219)(H,188,224)(H,189,226)(H,190,220)(H,191,211)(H,192,228)(H,193,227)(H,204,205)(H,206,207)(H4,157,158,163)(H4,159,160,164)(H4,161,162,165)/t77-,78-,79-,80-,81-,82+,88-,89-,90-,91-,92-,93-,94-,95-,96-,97-,98-,99-,100-,101-,102-,103-,104-,105-,106-,107-,108-,115-,116-,117-,118-/m0/s1 X markN
  • Key:WGWPRVFKDLAUQJ-MITYVQBRSA-N X markN
 X markNcheckY (what is this?)  (verify)

Sermorelin acetate (INNTooltip International Nonproprietary Name; brand names Geref, Gerel), also known as GHRH (1-29), is a peptide analogue of growth hormone-releasing hormone (GHRH) which is used as a diagnostic agent to assess growth hormone (GH) secretion for the purpose of diagnosing growth hormone deficiency.[2][3][4] It is a 29-amino acid polypeptide representing the 1–29 fragment from endogenous human GHRH, thought to be the shortest fully functional fragment of GHRH.[2]

Sermorelin was approved by the US Food and Drug Administration (FDA) in 1997 for use as a treatment for children with growth hormone deficiency or growth failure.[5] However, as of 2008, the manufacturer discontinued the production of Sermorelin for commercial reasons, and it is no longer available as an FDA-approved drug.[1][6] Despite this, it may still be used in some off-label contexts or obtained through compounding pharmacies.[7]

Medical usage

[edit]

Sermorelin was used to treat children with growth hormone deficiency or growth failure by stimulating the pituitary gland to release growth hormone (GH), thereby increasing plasma GH levels.[2]

Mechanism of action

[edit]

Sermorelin binds to the growth hormone-releasing hormone receptor (GHRHR), mimicking the effects of the full-length GHRH in promoting growth hormone secretion.[8]

Sermorelin's effects are regulated by negative feedback through the inhibitory hormone somatostatin, making it difficult to overdose, unlike exogenous rhGH (a synthetic version of human GH). This interaction with somatostatin prompts the pituitary to release hGH in bursts, which mirrors natural hormone rhythms rather than the constant levels produced by rhGH injections. As a result, sermorelin avoids tachyphylaxis by promoting a more physiological pattern of hGH release. Additionally, sermorelin stimulates the pituitary to enhance hGH gene transcription, thereby maintaining the growth hormone neuroendocrine system axis, which is the first to deteriorate with age. By supporting pituitary function, sermorelin helps slow the decline of pituitary hormones during aging, thereby preserving both youthful anatomy and physiology.[3]

Research potential

[edit]

GHRH naturally declines with age. No conclusive results are known whether sermorelin could yield potential benefits for adults, such as to enhance pituitary function or mimic growth hormone secretion patterns. Orally active growth hormone-releasing peptides may be under development. Sermorelin may be an alternative to rhGH for growth hormone replacement therapy (GHRT) in aging adults.

Sermorelin can be prescribed for off-label use without the legal restrictions that apply to rhGH. [3]

History

[edit]

Sermorelin acetate was developed as a truncated synthetic analogue of growth hormone-releasing hormone (GHRH) during research into peptide-based regulation of the hypothalamic–pituitary axis in the late 20th century. It was introduced into clinical practice primarily as a diagnostic tool for evaluating growth hormone secretion in children with suspected growth hormone deficiency.[9]

The compound gained regulatory approval in the United States in 1997 for diagnostic use, but its clinical adoption remained limited compared with other endocrine testing methods. In the early 2000s, its use declined as alternative diagnostic strategies and recombinant hormone assays became more widely available. Commercial production was discontinued in 2008 for non-safety-related business reasons, effectively removing it from the standard pharmaceutical market, although research interest in growth hormone-releasing peptides has continued.[10]

See also

[edit]

References

[edit]
Revisions and contributorsEdit on WikipediaRead on Wikipedia

Sermorelin

View on Grokipedia
from Grokipedia
Sermorelin is a synthetic peptide comprising the first 29 amino acids of the 44-amino-acid human growth hormone-releasing hormone (GHRH), also known as somatocrinin, with the chemical formula C149H246N44O42S and a molecular weight of 3357.9 g/mol.[1] It functions as a growth hormone secretagogue by binding to GHRH receptors on pituitary somatotroph cells, thereby stimulating the episodic release of endogenous growth hormone (GH) in a physiologically regulated manner, mimicking natural pulsatile secretion patterns.[1] Originally developed as a diagnostic and therapeutic agent for GH deficiency, Sermorelin was approved by the U.S. Food and Drug Administration (FDA) in 1997 under the brand name Geref for treating idiopathic growth hormone deficiency in children aged 2 years and older, where it promotes linear growth by enhancing pituitary GH production without direct GH administration. However, production was discontinued in 2008 for commercial reasons unrelated to safety or efficacy, leading to the withdrawal of its New Drug Applications (NDAs) in 2009, after which it is no longer available as an FDA-approved commercial product but remains eligible for generic approval and is often compounded by pharmacies for off-label use.[2] Administered via subcutaneous injection, Sermorelin is commonly given at night just before bedtime on an empty stomach to align with the body's natural peak growth hormone (GH) release during deep sleep, optimizing benefits such as muscle recovery, growth, fat metabolism, and overall effectiveness. Morning injections are possible and may provide some daytime energy benefits, but they are generally less optimal because they do not synchronize with the natural nocturnal GH pulse. For individuals engaging in workouts, nighttime injection supports better overnight recovery and tissue repair after exercise, with no reliable sources indicating that morning injections are superior specifically for morning workouts. Sermorelin has a short biological half-life of approximately 11-12 minutes, which contributes to its safety profile by preventing sustained GH elevation and associated risks like insulin resistance or acromegaly seen with recombinant human GH (rhGH) therapy.[1][3] In clinical practice, it has been employed diagnostically to evaluate pituitary function through GH stimulation tests and therapeutically to address growth failure in pediatric populations, with studies demonstrating improved growth velocity comparable to rhGH but with preserved endogenous GH axis integrity.[4] Compounded sermorelin is frequently used off-label in adults for age-related GH decline, body composition improvement (increased lean mass, reduced fat), enhanced recovery, energy, and wellness. See [#Dosage and Administration](/page/dosing protocols) for typical protocols. Benefits stem from restoring pulsatile GH release, though evidence is largely from observational and small studies; long-term data remain limited. Its use in these contexts is supported by evidence of tolerability, with common side effects limited to injection-site reactions and rare systemic effects like headache or flushing, though long-term safety data in adults remains limited.[4] As of 2026, Sermorelin remains a prescription-only peptide, available legitimately through telehealth providers requiring a licensed physician consultation, medical history review, lab testing (e.g., IGF-1 levels), and a valid prescription. It is compounded by FDA-registered pharmacies (not FDA-approved as a finished product) under Section 503A of the Federal Food, Drug, and Cosmetic Act for individual patient prescriptions, provided it meets USP standards and is not marketed as an approved drug, and is shipped directly to patients. Legitimate options include Ivy Rx (ivyrx.com), starting at $175/month (six-month plan, including medication, supplies, and follow-ups); Eden (tryeden.com), a telehealth platform for consultations and prescriptions; and ReadyRx, offering injectable and needle-free oral disintegrating tablet (ODT) sermorelin via prescription telehealth. Costs typically range from $175 to $500 per month. Patients should avoid unregulated online sellers or sites without prescriptions, as these risk counterfeit or unsafe products.[5][6][7][8] This status has fueled its popularity in anti-aging and performance enhancement circles. While some wellness clinics promote Sermorelin for cosmetic anti-aging effects such as improved skin elasticity, reduced wrinkles, and enhanced hair growth, reliable sources including Mayo Clinic and Healthline indicate limited scientific evidence supporting these benefits in healthy adults.[9][10] Sermorelin is not FDA-approved for anti-aging purposes, and growth hormone therapies in general carry potential risks such as joint pain, increased risk of diabetes, and concerns regarding cancer risk.[9] despite prohibitions in competitive sports due to its GH-boosting effects, underscoring the need for medical supervision to mitigate potential risks such as thyroid interference or hypersensitivity.[11] Ongoing research explores its role in broader endocrine therapies, emphasizing its advantage in maintaining pituitary responsiveness over direct GH replacement.[12]

General Information

Chemical Structure and Properties

Sermorelin is a synthetic peptide comprising 29 amino acids, serving as an analog of growth hormone-releasing hormone (GHRH). It corresponds precisely to the first 29 residues of the 44-amino acid human GHRH, with the key modification of amidation at the C-terminus to improve enzymatic stability while retaining the core biological functionality of the native hormone.[1][13] The amino acid sequence of Sermorelin is YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH₂, identical to residues 1–29 of endogenous human GHRH except for the C-terminal amidation. This sequence preserves the N-terminal domain critical for receptor binding and activation, ensuring functional equivalence to the full-length GHRH in eliciting growth hormone secretion, as the remaining C-terminal residues of native GHRH are not essential for potency.[1][14] Sermorelin has the molecular formula C₁₄₉H₂₄₆N₄₄O₄₂S and a molecular weight of 3,357.9 Da.[1] It is typically provided as the acetate salt in lyophilized form, appearing as a white to off-white amorphous powder that is freely soluble in water (at concentrations up to several mg/mL) and acetic acid, but practically insoluble in non-polar solvents like dichloromethane.[1][15] This formulation facilitates reconstitution for parenteral administration.[15]

History and Development

Sermorelin, a synthetic analog of growth hormone-releasing hormone (GHRH) comprising the first 29 amino acids of the natural hormone, was developed in the early 1980s by Serono Laboratories as a means to stimulate endogenous growth hormone (GH) secretion.[16] This innovation stemmed from research into hypothalamic peptides following the isolation of GHRH from human pancreatic tumors in 1982, with preclinical studies in the mid-1980s confirming its bioactivity in stimulating GH release in animal models, including rats, without the supraphysiological effects of direct GH administration.[2][17] Key milestones in its development included Phase III clinical trials conducted in the 1990s, which demonstrated Sermorelin's efficacy in diagnosing and treating idiopathic GH deficiency in children by safely increasing GH and insulin-like growth factor-1 (IGF-1) levels.[18] These trials, involving pediatric populations, supported its progression toward regulatory approval, culminating in U.S. Food and Drug Administration (FDA) approval under the brand name Geref in 1990 for a low-dose diagnostic formulation (0.05 mg base/amp) to evaluate pituitary function, and in 1997 for higher-dose therapeutic formulations (0.5 mg and 1.0 mg base/vial) specifically for treating growth failure due to idiopathic GH deficiency in children aged 2 years and older.[19][2] Post-approval, Sermorelin's commercial production faced challenges, leading EMD Serono (successor to Serono Laboratories) to discontinue manufacturing in 2008 due to economic and production difficulties, not issues of safety or efficacy, with the FDA withdrawing the new drug applications effective June 2009.[2][20] Following discontinuation, Sermorelin shifted to availability through compounding pharmacies in the United States under FDA guidelines for 503A facilities, allowing customized formulations for specific GH deficiency cases while prohibiting interstate shipping of non-FDA-approved versions.[2] As of 2025, it is regulated as a prescription drug in Canada by Health Canada and is available by prescription, typically through compounding pharmacies, similar to the situation in the United States.[21]

Pharmacology

Mechanism of Action

Sermorelin, a synthetic peptide analog of growth hormone-releasing hormone (GHRH), exerts its primary effects by binding to the GHRH receptor (GHRHR), a G-protein-coupled receptor located on the surface of somatotroph cells in the anterior pituitary gland.[22] This binding activates the receptor, which couples to the stimulatory G protein (Gs), thereby stimulating adenylate cyclase to catalyze the conversion of ATP to cyclic adenosine monophosphate (cAMP).[17] The resultant increase in intracellular cAMP levels activates protein kinase A (PKA), which phosphorylates key transcription factors such as CREB, promoting the expression of the growth hormone (GH) gene and enhancing GH synthesis within the somatotroph cells.[23] In parallel, the signaling cascade facilitates calcium influx through voltage-gated calcium channels in the plasma membrane, which is essential for the mobilization and exocytosis of GH-containing secretory granules.[23] This coordinated activation of the cAMP-dependent pathway and calcium signaling results in the regulated release of endogenous GH from the pituitary, maintaining physiological pulsatile secretion patterns that align with the natural rhythm of GHRH.[12] By stimulating endogenous GH production rather than directly administering recombinant GH, Sermorelin preserves the responsiveness of the pituitary gland and the integrity of the hypothalamic-pituitary-somatotropic axis, avoiding the negative feedback suppression that can occur with exogenous GH therapy.[12] This approach supports sustained pituitary reserve through upregulation of GH messenger RNA transcription, ensuring long-term efficacy without desensitization of the somatotropic system.[12] The downstream physiological effects of Sermorelin-mediated GH release include stimulation of insulin-like growth factor-1 (IGF-1) synthesis and secretion primarily in the liver, which mediates many of GH's anabolic actions while keeping circulating GH levels within normal physiological ranges.[12] Compared to native GHRH, a 44-amino-acid peptide, Sermorelin consists of the biologically active N-terminal 29-amino-acid sequence with a C-terminal amidation, a structural modification that confers greater resistance to enzymatic degradation by proteases such as dipeptidyl peptidase-IV, thereby improving its pharmacokinetic stability and duration of action.[24]

Pharmacokinetics

Sermorelin is administered primarily via subcutaneous injection, leading to rapid absorption. Following subcutaneous administration of 2 mg to healthy volunteers, peak plasma concentrations are reached within 5 to 20 minutes.[25] The absolute bioavailability after subcutaneous dosing is approximately 6%, reflecting partial degradation during absorption despite the quick onset.[25] Intravenous administration also results in fast distribution, with effects peaking around 15 to 60 minutes post-dose.[26] The drug exhibits a short plasma half-life of 11 to 12 minutes after either subcutaneous or intravenous administration, attributed to rapid enzymatic degradation by plasma peptidases.[25] Clearance rates in adults range from 2.4 to 2.8 L/min, preventing significant accumulation with repeated dosing.[25] Distribution occurs into the extracellular fluid compartment, with a volume of distribution of approximately 0.3 L/kg (23.7-25.8 L absolute) following intravenous dosing of 0.25 to 1.0 mg, allowing access to target tissues including the pituitary gland where it exerts its primary physiological effects.[25] Sermorelin undergoes enzymatic metabolism in plasma and tissues, primarily through cleavage by dipeptidyl peptidase-4 (DPP-4) and other proteases, yielding inactive fragments such as the GRF(3-29) metabolite.[24] No formal human metabolism studies are available, but this proteolytic breakdown accounts for its brief duration of action.[25] Elimination of sermorelin and its metabolites occurs mainly via renal excretion into the urine, consistent with the peptide's hydrophilic nature and rapid clearance.[27] The short half-life and efficient clearance ensure minimal risk of drug buildup, even with daily subcutaneous administration.[25]

Clinical Applications

Indications and Uses

Sermorelin acetate was FDA-approved from 1997 to 2008 for the treatment of idiopathic or organic growth hormone deficiency (GHD) in children with growth failure.[19] This indication targeted pediatric patients exhibiting short stature due to insufficient endogenous growth hormone production, where therapy aimed to stimulate natural pituitary secretion to support linear growth.[19] Following discontinuation for commercial reasons and NDA withdrawal in 2009, it is no longer available as an FDA-approved product but may be compounded by 503A pharmacies for individual prescriptions meeting USP standards as of 2026.[2][8] It was also employed as a diagnostic agent in growth hormone stimulation tests to assess pituitary function and confirm GHD.[14] Administered intravenously, sermorelin provoked growth hormone release, aiding in the differentiation of pituitary from hypothalamic deficiencies, though it may not fully exclude all cases of hypothalamic origin.[14] Compounded forms continue to be used for this purpose. Off-label applications include the management of adult-onset GHD, where sermorelin offers a physiologically regulated alternative to direct growth hormone replacement by enhancing endogenous production.[12] Limited evidence from studies on GHRH and related analogues (e.g., tesamorelin) supports potential benefits in HIV-associated lipodystrophy and wasting, with improvements in body composition and lean mass; specific data for sermorelin remains sparse.[28] In pediatric GHD, sermorelin therapy demonstrated efficacy by increasing height velocity from a baseline of approximately 4.1 cm/year to 7.2–8.0 cm/year over the first year, representing a gain of 3–4 cm/year.[29] It also normalized insulin-like growth factor-1 (IGF-1) levels, mitigating risks associated with exogenous growth hormone administration.[17] Patient selection requires confirmed GHD through provocative stimulation tests, such as sermorelin or insulin tolerance testing, to verify inadequate growth hormone response.[14] Organic causes, including pituitary tumors or other intracranial lesions, must be excluded via neuroimaging like MRI prior to initiation, as active neoplasms contraindicate therapy.[30]

Combination with Testosterone Replacement Therapy

Sermorelin is frequently used off-label in combination with testosterone replacement therapy (TRT) in adult men seeking hormone optimization. Unlike TRT, which directly supplements exogenous testosterone to address hypogonadism, Sermorelin stimulates endogenous growth hormone (GH) production via the pituitary gland and does not directly increase testosterone levels. The two therapies operate on distinct hormonal axes, making them complementary rather than conflicting. Clinical observations and small-scale studies suggest potential synergistic effects when combined, including enhanced improvements in body composition (greater fat loss and lean muscle gains), better muscle recovery, increased energy and stamina, improved sleep quality, and overall vitality beyond what TRT alone provides. Some reports indicate that adding GH-stimulating therapies like Sermorelin to TRT may support or stabilize testosterone-related benefits, though Sermorelin itself does not elevate testosterone directly. No major negative interactions are commonly reported when both are properly dosed and monitored, but individual responses vary. Regular lab monitoring (including IGF-1 for GH axis, testosterone/estradiol, hematocrit, and cardiovascular markers) is essential. Regarding blood pressure, evidence is mixed: optimized GH levels may support vascular function and cholesterol profiles for potential cardiovascular benefits, while transient changes in heart rate or blood pressure can occur during adjustment periods. Chronic excess GH (more associated with direct rhGH than pulsatile Sermorelin) has been linked to hypertension risks in some contexts, underscoring the need for medical supervision. This combination is popular in men's health and anti-aging clinics but remains off-label and not FDA-approved for these purposes. Patients considering this should consult a qualified endocrinologist or hormone specialist for personalized assessment.

Dosage and Administration

Sermorelin is administered via subcutaneous injection. There is no universal standard dose, as dosing is highly individualized based on factors such as age, weight, sex, baseline IGF-1 levels, treatment goals, and response to therapy, always under medical supervision. For historical FDA-approved pediatric use (discontinued), dosing was typically weight-based, such as around 30 μg/kg body weight once daily at bedtime in some protocols for growth hormone deficiency in children. In modern off-label adult use with compounded Sermorelin (e.g., for age-related GH decline, body composition, or wellness), common protocols include:
  • Starting/common dose: 200–300 μg (0.2–0.3 mg) once daily, usually at bedtime on an empty stomach.
  • Typical range: 100–500 μg per day, with some protocols up to 400–500 μg or occasionally higher for specific goals.
  • Frequency: Often 5–7 nights per week, sometimes on a 5 days on/2 days off schedule to maintain pituitary sensitivity.
Doses are often started conservatively and titrated based on follow-up labs (e.g., IGF-1) and symptoms. Women may start lower (100–300 μg), while men may use higher ends (200–500 μg) in some practices. Administration aligns with natural GH pulses, preferably at night, 60–90 minutes after the last meal, with a wait of 30–60 minutes before eating post-injection.[31] These ranges reflect common compounding pharmacy guidelines and clinical practices as of 2026, but exact dosing must be prescribed and monitored by a qualified healthcare provider. If a dose of Sermorelin is missed, it should be administered as soon as remembered. If it is almost time for the next scheduled dose, the missed dose should be skipped and the regular dosing schedule resumed. Doubling the dose to compensate for a missed one is not advised. A single missed dose typically does not significantly impact treatment, but consistent daily dosing is important for optimal results, as repeated missed doses can reduce effectiveness over time.[32] For diagnostic evaluation of growth hormone deficiency, a single intravenous dose of 1 mcg/kg is used in stimulation testing, with growth hormone levels measured at baseline and at intervals (typically 15, 30, 60, and 120 minutes post-administration) over a 2-hour period to assess pituitary responsiveness.[14][33] The lyophilized powder form of sermorelin requires reconstitution prior to use, typically with bacteriostatic water for injection or sterile sodium chloride solution (0.9%), by directing the solvent against the vial wall and gently swirling to dissolve without shaking to avoid foaming.[25][34] Subcutaneous injections are performed using a sterile insulin syringe, preferably in the abdomen or thigh, with rotation of sites to minimize local irritation; the solution should appear clear and free of particles before administration.[25] Reconstituted sermorelin is stored refrigerated at 2-8°C (36-46°F) and protected from light, remaining stable for up to 14-30 days depending on the diluent used.[25][35] Therapeutic treatment with sermorelin is generally long-term, extending up to 1-2 years or longer in cases of idiopathic growth hormone deficiency, with efficacy assessed through regular monitoring of insulin-like growth factor 1 (IGF-1) levels every 3-6 months to guide continuation and ensure levels remain within the normal range for age and sex.[14][36] If no clinical response, such as improved growth velocity, is observed after 6 months, discontinuation is recommended.[37] Dose adjustments are advised in patients with renal impairment, starting at a reduced level (e.g., 50% of standard dose) and titrating based on IGF-1 response and renal function monitoring, due to potential alterations in clearance.[38][17]

Safety Profile

Adverse Effects

Sermorelin therapy is generally well tolerated, with most adverse effects being mild and transient. Common side effects, occurring in more than 10% of patients, include injection site reactions such as pain, redness, and swelling, reported in approximately 17% of participants in clinical trials involving over 350 pediatric patients.[25] Headache and facial flushing are also frequently observed, often resolving shortly after administration.[14] Less common adverse effects, affecting 1-10% of users, encompass hyperactivity, somnolence, dizziness, and nausea. These systemic reactions typically occur at rates below 1% individually but contribute to an overall adverse event incidence of around 20% in pediatric studies, predominantly mild and self-limiting without leading to discontinuation in most cases.[25] Rare and serious adverse effects, seen in less than 1% of patients, include allergic reactions manifesting as rash, urticaria, or, exceptionally, anaphylaxis; orthostatic hypotension; and development of antibodies against growth hormone-releasing hormone, which occurred in a large proportion of treated children and may diminish therapeutic efficacy over time.[25] Long-term use of sermorelin carries theoretical risks such as insulin resistance and joint pain, but these are considered lower than those associated with direct recombinant human growth hormone therapy due to sermorelin's promotion of physiological pulsatile growth hormone release, which maintains natural feedback mechanisms and reduces supraphysiological exposure.[12] No significant long-term metabolic disruptions or increased cancer risk have been substantiated in available clinical data for sermorelin.[17] In addition to the common and less common effects, off-label use in adults has reported joint and muscle pain, peripheral edema (swelling in extremities), and paresthesia (tingling or numbness), which could potentially exacerbate symptoms in patients with peripheral neuropathy. Insulin resistance may occur, potentially affecting blood glucose control in those with diabetic neuropathy. These effects are generally less pronounced than with direct rhGH due to pulsatile release but warrant monitoring. \n \nCardiovascular effects are generally mild and uncommon with Sermorelin due to its short half-life and pulsatile growth hormone stimulation. Some sources report potential benefits to blood pressure and vascular health through improved cholesterol profiles and endothelial function in growth hormone-deficient states. However, transient changes in blood pressure or heart rate may occur during initiation or dose adjustment. Chronic supraphysiological growth hormone elevation (less likely with Sermorelin than with direct recombinant human growth hormone therapy) has been associated with hypertension, cardiac hypertrophy, or other risks. Patients with pre-existing hypertension should have blood pressure well-controlled before starting, and regular monitoring is recommended during therapy.

Discontinuation and Withdrawal

Unlike direct exogenous growth hormone therapy, discontinuation of Sermorelin does not result in a classic withdrawal syndrome. Sermorelin stimulates the pituitary gland to produce endogenous GH in a pulsatile manner, preserving natural feedback mechanisms and avoiding long-term suppression of the somatotropic axis. Upon discontinuation of Sermorelin, the stimulated GH pulsatile release returns to baseline gradually, typically over weeks, without evidence of significant axis suppression. Benefits like enhanced growth velocity (in approved use) or off-label improvements in body composition, energy, and recovery fade progressively. No post-cycle therapy is needed, as the peptide preserves natural pituitary function. Users may experience a gradual fade of therapeutic benefits, such as reduced energy, slower recovery, or return of pre-treatment symptoms related to lower GH/IGF-1 levels, but no severe or dangerous withdrawal effects are reported. This contrasts with abrupt cessation of suppressive therapies like anabolic steroids or high-dose exogenous GH, which can lead to rebound deficiencies. Long-term or cyclic use is preferred to sustain effects while minimizing any theoretical desensitization risks. Monitoring via bloodwork (e.g., IGF-1) post-discontinuation is advisable, especially in off-label adult use. Tapering doses over 1-2 weeks may ease the transition, though cold turkey cessation is generally safe based on available clinical and anecdotal data.

Contraindications and Precautions

Sermorelin is contraindicated in individuals with known hypersensitivity to sermorelin or other growth hormone-releasing hormone (GHRH) analogs, which can lead to severe allergic reactions.[25][32] Use in patients with active malignancy is not recommended, as growth hormone stimulation may promote tumor growth due to its mitogenic effects.[39] Relative contraindications include the presence of intracranial lesions, where sermorelin is not recommended due to potential exacerbation of underlying pathology in growth hormone deficiency cases.[25][34] Uncontrolled hypothyroidism represents another relative contraindication, as it may interfere with sermorelin's efficacy in stimulating growth hormone release; the incidence of hypothyroidism during therapy is approximately 6.5%.[25][40] Sermorelin is classified as pregnancy category C, indicating that it should be used only if the potential benefit justifies the risk to the fetus, based on animal studies showing minor variations at high doses. No animal model studies have demonstrated or investigated Sermorelin excretion into breast milk. Due to the lack of pharmacokinetic data in lactation, Sermorelin should not be used during breastfeeding, as potential risks to the infant are unknown.[25][32] Drug interactions with sermorelin can reduce its therapeutic efficacy, particularly with concomitant use of glucocorticoids, which inhibit the growth hormone response, or somatostatin analogs, which suppress pituitary hormone secretion.[25][32] Caution is advised when combining sermorelin with insulin or oral antidiabetic agents, as growth hormone stimulation may alter glucose metabolism and affect blood sugar control.[32] Precautions for sermorelin therapy include baseline screening of thyroid function and insulin-like growth factor-1 (IGF-1) levels to ensure appropriate candidacy and monitor response.[25] In patients with a history of cancer, regular monitoring for tumor growth is essential, given the theoretical risk of recurrence promoted by elevated growth hormone.[12] Therapy should be avoided in active proliferative conditions, such as uncontrolled diabetes or retinopathy, to prevent potential worsening.[25] In special populations, sermorelin is not recommended for children under 2 years of age due to limited safety data in infants.[4] Dose adjustments may be necessary in obese patients, as higher body mass can blunt the growth hormone response, and caution is warranted in those with renal failure, where no specific data exist but general growth hormone therapy risks apply.[25][41] For compounded sermorelin used off-label in adults as of 2025, long-term safety data remains limited, and use should occur under medical supervision to ensure quality and monitor for adverse effects.[8] While not formally contraindicated, caution is advised in elderly patients with dementia or peripheral neuropathy due to possible exacerbation of cognitive fluctuations (from headache, dizziness, or sleep changes) or neuropathic symptoms (from joint/nerve pain, edema, or paresthesia). Metabolic effects like insulin resistance may complicate comorbid diabetes contributing to neuropathy. Consultation with specialists and close monitoring of IGF-1, glucose, and symptoms is essential for off-label use in such populations.

Research and Future Directions

Current Research Findings

Research on Sermorelin has shifted toward its off-label use in compounded formulations since its discontinuation as an FDA-approved product in 2008, with few new randomized controlled trials but reliance on historical data, reviews, and observational studies for growth hormone (GH) stimulation. In pediatric growth hormone deficiency (GHD), early clinical trials prior to 2008 demonstrated Sermorelin's efficacy in stimulating endogenous GH release and promoting growth, though contemporary pediatric use has declined in favor of recombinant human GH (rhGH) due to availability.[14] For adult applications, historical studies on Sermorelin for age-related GH decline have shown increases in insulin-like growth factor-1 (IGF-1) levels and variable effects on body composition, such as reductions in fat mass and gains in lean mass.[12] Long-term safety data from early trials indicate low immunogenicity, with rare development of antibodies, and no established increased cancer risk in GH-deficient populations. Direct comparative trials against other GH secretagogues like tesamorelin are lacking, though Sermorelin has demonstrated good tolerability in historical use. As of 2025, Sermorelin compounding is permitted under Section 503A of the Federal Food, Drug, and Cosmetic Act by licensed pharmacies meeting USP standards, with emphasis on quality oversight; no specific ongoing clinical trials for HIV-associated lipodystrophy involving Sermorelin are reported.[8] Studies on growth hormone-releasing hormone (GHRH) administration, including analogs like tesamorelin, have shown favorable short-term effects on executive function and verbal memory in healthy older adults and those with mild cognitive impairment (MCI), with increases in IGF-1 within physiological ranges. However, direct evidence for Sermorelin in established dementia is lacking, and one trial with a different GH secretagogue did not slow Alzheimer's progression. Use in patients with dementia or neuropathy should be approached cautiously due to potential side effects like confusion, dizziness, or nerve-related discomfort, and requires medical supervision.

Potential Therapeutic Applications

Sermorelin, as a growth hormone-releasing hormone (GHRH) analog, has been investigated in early-phase human studies for potential applications in age-related declines. In older adults, it stimulates pulsatile endogenous GH and IGF-1 secretion, which may help counteract sarcopenia. A 1997 study in elderly subjects reported an increase in lean body mass of 1.26 kg in men after 16 weeks of therapy, alongside improvements in muscle strength in some tests.[17] Preclinical data from aged rat models show pituitary recrudescence and restored GH dynamics, suggesting benefits for preserving physiological function in aging.[12] Although a 1997 study reported increases in skin thickness after 16 weeks, supporting potential benefits for tissue integrity, this evidence is preliminary and limited to small studies. Broader cosmetic anti-aging effects, such as reduced wrinkles or improved hair growth, lack robust scientific support in healthy adults.[9] though data on bone density are limited. Research on growth hormone-releasing hormone (GHRH) analogs, including compounds similar to Sermorelin, has investigated potential cognitive benefits in older adults and those with mild cognitive impairment (MCI). A 2012 randomized controlled trial found that GHRH administration improved cognitive function in adults with MCI and healthy older adults. However, direct evidence for Sermorelin in dementia or other cognitive disorders is limited. Caution is recommended for patients with cognitive impairment or neuropathy, given the potential for side effects such as paresthesia, edema, joint pain, or insulin resistance to exacerbate symptoms or cause metabolic changes. In metabolic disorders, Sermorelin has shown promise in early studies for obesity and type 2 diabetes through IGF-1 modulation affecting lipolysis and glucose homeostasis. A pilot study in elderly men with low IGF-1 levels reported enhanced insulin sensitivity and lean mass gains without significant glucose disruptions, unlike direct GH administration.[17] Sermorelin's investigational role in sports and performance enhancement focuses on muscle recovery via natural GH release to support lean mass and endurance, mimicking endogenous pulsatility. However, it has been prohibited by the World Anti-Doping Agency (WADA) since the early 2000s under GHRH analogs due to performance-enhancing potential.[42] Key limitations include the scarcity of large-scale randomized controlled trials confirming long-term efficacy and safety. Short-term studies report outcomes like decreased systolic blood pressure, but more data are needed on cardiovascular risks, including lipid profiles and endothelial function. As of November 2025, research remains limited, with emphasis on compounded use under regulatory guidelines.

References

  1. Sermorelin | C149H246N44O42S | CID 16132413 - PubChem - NIH
  2. Determination That GEREF (Sermorelin Acetate) Injection, 0.5 ...
  3. Morning vs. Night: The Best Time to Take Sermorelin
  4. Sermorelin (injection route) - Side effects & dosage - Mayo Clinic
  5. IVY RX Website
  6. Eden Website
  7. ReadyRx Website
  8. Regulatory Status of Peptide Compounding in 2025 - Frier Levitt
  9. Human growth hormone (HGH): Does it slow aging?
  10. Sermorelin Therapy Benefits, Risks, Uses, Approval, and Side Effects
  11. What Should Athletes Know About Sermorelin? - USADA
  12. Sermorelin: A better approach to management of adult-onset growth ...
  13. sermorelin | Ligand page - IUPHAR/BPS Guide to PHARMACOLOGY
  14. Sermorelin: a review of its use in the diagnosis and treatment of ...
  15. [PDF] sermorelin-acetate.pdf
  16. Exploring FDA-Approved Frontiers: Insights into Natural and ...
  17. Beyond the androgen receptor: the role of growth hormone secretagogues in the modern management of body composition in hypogonadal males
  18. https://pubmed.ncbi.nlm.nih.gov/9005976/
  19. Search Orphan Drug Designations and Approvals - FDA
  20. Growth hormone secretagogues: history, mechanism of action, and ...
  21. Prescription Drug List - Drug and Health Product Register
  22. Sermorelin: Uses, Interactions, Mechanism of Action - DrugBank
  23. Growth Hormone-Releasing Hormone in Diabetes - PMC - NIH
  24. Qualitative identification of growth hormone-releasing ... - NIH
  25. Sermorelin Acetate
  26. [PDF] Part II Summary of Product Characteristics - HPRA
  27. sermorelin | Dosing & Uses - medtigo
  28. https://pmc.ncbi.nlm.nih.gov/articles/PMC3218714/
  29. Once daily subcutaneous growth hormone-releasing ... - PubMed
  30. Safety of growth hormone replacement in survivors of cancer and ...
  31. https://www.peptideschedule.com/peptides/sermorelin
  32. Sermorelin acetate: Indications, Side Effects, Warnings
  33. What is the recommended dosage of Sermorelin (growth hormone ...
  34. Sermorelin Acetate Injection - Empower Pharmacy
  35. https://www.tryeden.com/post/does-sermorelin-need-to-be-refrigerated
  36. Sermorelin Peptide: Guide for Practitioners and Patients - Rupa Health
  37. What are the monitoring, management, dosing regimens, risks, and ...
  38. Are there concerns with using sermorelin in patients with impaired ...
  39. https://farmakeio.com/wp-content/uploads/2025/08/Sermorelin-Injection.pdf
  40. Sermorelin Peptide Benefits - Anderson Longevity Clinic
  41. Sermorelin - an overview | ScienceDirect Topics
  42. The Prohibited List | World Anti Doping Agency - WADA
User Avatar
No comments yet.